Tools     Alignment Analysis   Databases   Computational Immunology   Modeling & 3D-structure     Analysis   Sequence Manipulation &     Analysis   Similarity Searches   View all Tools    Tools    >> Tapreg  TAPREG  Plea for Support If you have found this resource useful for your research, please, tell about it to the SECRETARIA GENERAL DE CIENCIA, TECNOLOGIA E INNOVACION OF SPAIN (sgcti@mineco.es, dgi@mineco.es).Your support will be crucial to keep it up and running. Thanks. This server computes binding affinity of peptides to TAP (Transporter Associated with Antigen Processing) using a Support Vector Machine Regression. E-MAIL Enter your e-mail (optional) THRESHOLD ---- 1000 1500 2000 2500 3000 3500 4000 5000 6000 7000 8000 9000 10000 20000 50000  Affinity threshold (IC50) MODELS DS_613 Sparse  DS_613 Blosum  INPUT Protein Peptides Replace examples with your sequence(s) (FASTA Format) >gi|82503281|ref|YP_401725.1| BDLF3.5 [Human herpesvirus 4 type 1] MSAPGCSERQDKKRGTIGEREFGELLSWDPTDLPRTVARVYVAVGGLFEQEVSEVQRLENICTLLDLAGVECQTKAD or Upload sequence(s) from local file. 1. Browse file 2.Load file: Citation: Diez-Rivero CM, Chenlo B, Zuluzga P and Reche PA (2010) Quantitative modeling of peptide binding to TAP using support vector machine. Proteins, 78:63-72 Credits & Complaints: Pedro A. Reche Hits since Mar/2009 Last updated: Contact Us    |   Immunomedicine Group    |